Apolipoprotein B-100, Recombinant, Human, aa28-127

Catalog Number: USB-583653
Article Name: Apolipoprotein B-100, Recombinant, Human, aa28-127
Biozol Catalog Number: USB-583653
Supplier Catalog Number: 583653
Alternative Catalog Number: USB-583653-20,USB-583653-100,USB-583653-1
Manufacturer: US Biological
Category: Molekularbiologie
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.. Partial recombinant protein corresponding to aa28-127 from human Apolipoprotein B-100, fused to 10X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P04114. Molecular Weight: ~14.7kD Amino Acid Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.7
UniProt: P04114
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, pH 8.0, 50% glycerol