Apolipoprotein C-I, Recombinant, Mouse, aa27-88, His-Tag

Catalog Number: USB-583658
Article Name: Apolipoprotein C-I, Recombinant, Mouse, aa27-88, His-Tag
Biozol Catalog Number: USB-583658
Supplier Catalog Number: 583658
Alternative Catalog Number: USB-583658-20,USB-583658-100
Manufacturer: US Biological
Category: Molekularbiologie
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Source: Recombinant protein corresponding to aa27-88 from mouse Apolipoprotein C-I, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~12.5kD Amino Acid Sequence: APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.5
UniProt: P34928
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.