Apolipoprotein C-I, Recombinant, Rat, aa27-88, hFc-Tag

Catalog Number: USB-583659
Article Name: Apolipoprotein C-I, Recombinant, Rat, aa27-88, hFc-Tag
Biozol Catalog Number: USB-583659
Supplier Catalog Number: 583659
Alternative Catalog Number: USB-583659-20, USB-583659-100
Manufacturer: US Biological
Category: Molekularbiologie
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. Source: Recombinant protein corresponding to aa27-88 from rat Apolipoprotein C-I, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~34.7kD Amino Acid Sequence: APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.7
UniProt: P19939
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.