Appetite-regulating Hormone, Recombinant, Mouse, aa24-117, His-Tag

Catalog Number: USB-583672
Article Name: Appetite-regulating Hormone, Recombinant, Mouse, aa24-117, His-Tag
Biozol Catalog Number: USB-583672
Supplier Catalog Number: 583672
Alternative Catalog Number: USB-583672-20,USB-583672-100
Manufacturer: US Biological
Category: Molekularbiologie
Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation., Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility. Source: Recombinant protein corresponding to aa24-117 from mouse Appetite-regulating hormone, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~14.8kD Amino Acid Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.8
UniProt: Q9EQX0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.