Arsenical Resistance Operon Repressor, Recombinant, Escherichia coli, aa1-117, His-Tag

Catalog Number: USB-583679
Article Name: Arsenical Resistance Operon Repressor, Recombinant, Escherichia coli, aa1-117, His-Tag
Biozol Catalog Number: USB-583679
Supplier Catalog Number: 583679
Alternative Catalog Number: USB-583679-20,USB-583679-100
Manufacturer: US Biological
Category: Molekularbiologie
Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)). Source: Recombinant protein corresponding to aa1-117 from Escherichia coli Arsenical resistance operon repressor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.0kD Amino Acid Sequence: MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19
UniProt: P37309
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.