ATP Synthase Subunit G Mitochondrial, Recombinant, Bovine, aa2-103, His-Tag, Myc-Tag

Catalog Number: USB-583703
Article Name: ATP Synthase Subunit G Mitochondrial, Recombinant, Bovine, aa2-103, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583703
Supplier Catalog Number: 583703
Alternative Catalog Number: USB-583703-20,USB-583703-100
Manufacturer: US Biological
Category: Molekularbiologie
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. Source: Recombinant protein corresponding to aa2-103 from bovine ATP synthase subunit g, mitochondrial, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~18.7kD Amino Acid Sequence: AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.7
UniProt: Q28852
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.