B Melanoma Antigen 2, Recombinant, Human, aa18-109, His-Tag, Myc-Tag

Catalog Number: USB-583737
Article Name: B Melanoma Antigen 2, Recombinant, Human, aa18-109, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583737
Supplier Catalog Number: 583737
Alternative Catalog Number: USB-583737-20,USB-583737-100
Manufacturer: US Biological
Category: Molekularbiologie
Unknown. Candidate gene encoding tumor antigens. Source: Recombinant protein corresponding to aa18-109 from human B melanoma antigen 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.9kD Amino Acid Sequence: RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.9
UniProt: Q86Y30
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.