B-cell Receptor CD22, Recombinant, Human, aa553-672, His-SUMO-Tag

Catalog Number: USB-583744
Article Name: B-cell Receptor CD22, Recombinant, Human, aa553-672, His-SUMO-Tag
Biozol Catalog Number: USB-583744
Supplier Catalog Number: 583744
Alternative Catalog Number: USB-583744-20,USB-583744-100
Manufacturer: US Biological
Category: Molekularbiologie
Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins, one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Source: Recombinant protein corresponding to aa553-672 from human B-cell receptor CD22, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.3kD Amino Acid Sequence: ESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.3
UniProt: P20273
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.