Beta-defensin 126, Recombinant, Pongo pygmaeus, aa21-63, GST-Tag

Catalog Number: USB-583769
Article Name: Beta-defensin 126, Recombinant, Pongo pygmaeus, aa21-63, GST-Tag
Biozol Catalog Number: USB-583769
Supplier Catalog Number: 583769
Alternative Catalog Number: USB-583769-20,USB-583769-100
Manufacturer: US Biological
Category: Molekularbiologie
Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Source: Recombinant protein corresponding to aa21-63 from Pongo pygmaeus Beta-defensin 126, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~31.9kD Amino Acid Sequence: SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.9
UniProt: A4H244
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.