Beta-lactamase CTX-M-2, Recombinant, Salmonella typhimurium, aa29-291, His-Tag

Catalog Number: USB-583784
Article Name: Beta-lactamase CTX-M-2, Recombinant, Salmonella typhimurium, aa29-291, His-Tag
Biozol Catalog Number: USB-583784
Supplier Catalog Number: 583784
Alternative Catalog Number: USB-583784-20,USB-583784-100
Manufacturer: US Biological
Category: Molekularbiologie
Has cefotaxime-hydrolyzing activity. Source: Recombinant protein corresponding to aa29-291 from Salmonella typhimurium Beta-lactamase CTX-M-2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.4kD Amino Acid Sequence: QANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAESRRDILAAAAKIVTHGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.4
UniProt: P74841
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.