Beta-synuclein, Recombinant, Mouse, aa1-133

Catalog Number: USB-583795
Article Name: Beta-synuclein, Recombinant, Mouse, aa1-133
Biozol Catalog Number: USB-583795
Supplier Catalog Number: 583795
Alternative Catalog Number: USB-583795-20,USB-583795-100
Manufacturer: US Biological
Category: Molekularbiologie
May be involved in neuronal plasticity. Partial recombinant protein corresponding to aa1-133 from mouse Beta-synuclein, expressed in E.coli. Molecular Weight: ~14.1kD Amino Acid Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.1
UniProt: Q91ZZ3
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.