Beta-synuclein, Recombinant, Rat, aa1-137, His-Tag

Product Overview

• Article Name: Beta-synuclein, Recombinant, Rat, aa1-137, His-Tag
• Biozol Catalog Number: USB-583796
• Supplier Catalog Number: 583796
• Alternative Catalog Number: USB-583796-20,USB-583796-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May be involved in neuronal plasticity. Source: Recombinant protein corresponding to aa1-137 from rat Beta-synuclein, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.5kD Amino Acid Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEAKGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.5
• UniProt: Q63754
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.