Beta-tectorin, Recombinant, Mouse, aa18-305, His-B2M-JD-Tag, Myc

Catalog Number: USB-583799
Article Name: Beta-tectorin, Recombinant, Mouse, aa18-305, His-B2M-JD-Tag, Myc
Biozol Catalog Number: USB-583799
Supplier Catalog Number: 583799
Alternative Catalog Number: USB-583799-20,USB-583799-100
Manufacturer: US Biological
Category: Molekularbiologie
One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Source: Recombinant protein corresponding to aa18-305 from mouse Beta-tectorin, fused to 10X His-B2M-JD-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~39.4kD Amino Acid Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.4
UniProt: O08524
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.