Blood Group Rh(D) Polypeptide, Recombinant, Human, aa388-417, GST-Tag

Catalog Number: USB-583809
Article Name: Blood Group Rh(D) Polypeptide, Recombinant, Human, aa388-417, GST-Tag
Biozol Catalog Number: USB-583809
Supplier Catalog Number: 583809
Alternative Catalog Number: USB-583809-20,USB-583809-100
Manufacturer: US Biological
Category: Molekularbiologie
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Recombinant protein corresponding to aa388-417 from human Blood group Rh(D) polypeptide, fused to GST-Tag at N-terminal, expressed in Mammalian cell. Swiss/Uniprot: Q02161 Molecular Weight: ~29.6kD Amino Acid Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.6
UniProt: Q02161
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.