Bone Marrow Proteoglycan, Recombinant, Human, aa106-222, His-SUMO-Tag

Catalog Number: USB-583810
Article Name: Bone Marrow Proteoglycan, Recombinant, Human, aa106-222, His-SUMO-Tag
Biozol Catalog Number: USB-583810
Supplier Catalog Number: 583810
Alternative Catalog Number: USB-583810-20,USB-583810-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Recombinant protein corresponding to aa106-222 from human Bone marrow proteoglycan, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.8kD Amino Acid Sequence: TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.8
UniProt: P13727
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.