Bone Morphogenetic Protein 8B, Recombinant, Mouse, aa261-399, His-SUMO-Tag
Biozol Catalog Number:
USB-583816
Supplier Catalog Number:
583816
Alternative Catalog Number:
USB-583816-20,USB-583816-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis (By similarity). Involved in the generation of primordial germ cells, this function involves Bmp4 in a synergistic manner though separate receptor complexes seem to be involved. Required for the initiation and maintenance of spermatogenesis. Signaling protein involved in regulation of thermogenesis and energy balance. Proposed to increase the peripheral response of brown adipose tissue (BAT) to adrenergic stimulation while acting centrally in the hypothalamus to increase sympathetic output to BAT. Source: Recombinant protein corresponding to aa261-399 from mouse Bone morphogenetic protein 8B, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.7kD Amino Acid Sequence: TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
