BPI Fold-containing Family A Member 2, Recombinant, Human, aa19-249

Catalog Number: USB-583820
Article Name: BPI Fold-containing Family A Member 2, Recombinant, Human, aa19-249
Biozol Catalog Number: USB-583820
Supplier Catalog Number: 583820
Alternative Catalog Number: USB-583820-20,USB-583820-100
Manufacturer: US Biological
Category: Molekularbiologie
Has strong antibacterial activity against P. aeruginosa. Source: Recombinant protein corresponding to aa19-249 from human BPI fold-containing family A member 2, expressed in Yeast. Molecular Weight: ~25.1kD Amino Acid Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.1
UniProt: Q96DR5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.