Branched-chain-amino-acid Aminotransferase, Cytosolic, Recombinant, Mouse, aa1-386, His-Tag

Catalog Number: USB-583825
Article Name: Branched-chain-amino-acid Aminotransferase, Cytosolic, Recombinant, Mouse, aa1-386, His-Tag
Biozol Catalog Number: USB-583825
Supplier Catalog Number: 583825
Alternative Catalog Number: USB-583825-20,USB-583825-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. Source: Recombinant protein corresponding to aa1-386 from mouse Branched-chain-amino-acid aminotransferase, cytosolic, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~46.4kD Amino Acid Sequence: MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.4
UniProt: P24288
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol