Brevican Core Protein, Recombinant, Rat, aa658-786, His-Tag, Myc-Tag

Product Overview

• Article Name: Brevican Core Protein, Recombinant, Rat, aa658-786, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-583828
• Supplier Catalog Number: 583828
• Alternative Catalog Number: USB-583828-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor. Source: Recombinant protein corresponding to aa658-786 from rat Brevican core protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~19kD Amino Acid Sequence: DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19
• UniProt: P55068
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.