Butyrophilin Subfamily 3 Member A1, Recombinant, Human, aa30-254, His-Tag

Product Overview

• Article Name: Butyrophilin Subfamily 3 Member A1, Recombinant, Human, aa30-254, His-Tag
• Biozol Catalog Number: USB-583831
• Supplier Catalog Number: 583831
• Alternative Catalog Number: USB-583831-20,USB-583831-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways. Source: Recombinant protein corresponding to aa30-254 from human Butyrophilin subfamily 3 member A1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.2kD Amino Acid Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.2
• UniProt: O00481
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.