C-C Chemokine Receptor Type 8, Recombinant, Human, aa1-35, His-Myc-Tag

Product Overview

• Article Name: C-C Chemokine Receptor Type 8, Recombinant, Human, aa1-35, His-Myc-Tag
• Biozol Catalog Number: USB-583835
• Supplier Catalog Number: 583835
• Alternative Catalog Number: USB-583835-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. Source: Recombinant protein corresponding to aa1-35 from human C-C chemokine receptor type 8, fused to 6X His-Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~7.7kD Amino Acid Sequence: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 7.7
• UniProt: P51685
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.