C-C Chemokine Receptor Type 8, Recombinant, Human, aa74-129, His-Tag
Biozol Catalog Number:
USB-583837
Supplier Catalog Number:
583837
Alternative Catalog Number:
USB-583837-20,USB-583837-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. Source: Recombinant protein corresponding to aa74-129 from human C-C chemokine receptor type 8, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~9.4kD Amino Acid Sequence: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted