C-C Motif Chemokine 17, Recombinant, Canine, aa24-99, His-KSI-Tag

Catalog Number: USB-583841
Article Name: C-C Motif Chemokine 17, Recombinant, Canine, aa24-99, His-KSI-Tag
Biozol Catalog Number: USB-583841
Supplier Catalog Number: 583841
Alternative Catalog Number: USB-583841-20,USB-583841-100
Manufacturer: US Biological
Category: Molekularbiologie
Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8. Source: Recombinant protein corresponding to aa24-99 from canine C-C motif chemokine 17, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.9kD Amino Acid Sequence: ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.9
UniProt: Q95N01
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.