C-type Lectin Domain Family 4 Member E, Recombinant, Mouse, aa46-214, His-Tag

Catalog Number: USB-583850
Article Name: C-type Lectin Domain Family 4 Member E, Recombinant, Mouse, aa46-214, His-Tag
Biozol Catalog Number: USB-583850
Supplier Catalog Number: 583850
Alternative Catalog Number: USB-583850-20,USB-583850-100
Manufacturer: US Biological
Category: Molekularbiologie
Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs notably include mycobacterial trehalose 6,6-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions. Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells. Binding of mycobacterial trehalose 6,6-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 (Th1) and T-helper 17 (Th17) cell subtypes. Also recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation. Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue. Source: Recombinant protein corresponding to aa46-214 from mouse C-type lectin domain family 4 member E, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.6kD Amino Acid Sequence: TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.6
UniProt: Q9R0Q8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.