C-X-C Chemokine Receptor Type 2, Recombinant, Human, aa1-40, His-SUMO-Tag

Catalog Number: USB-583854
Article Name: C-X-C Chemokine Receptor Type 2, Recombinant, Human, aa1-40, His-SUMO-Tag
Biozol Catalog Number: USB-583854
Supplier Catalog Number: 583854
Alternative Catalog Number: USB-583854-20,USB-583854-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Source: Recombinant protein corresponding to aa1-40 from human C-X-C chemokine receptor type 2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.6kD Amino Acid Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.6
UniProt: P25025
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.