Calmodulin Regulator Protein PCP4, Recombinant, Mouse, aa1-62, His-Tag, Myc-Tag

Product Overview

• Article Name: Calmodulin Regulator Protein PCP4, Recombinant, Mouse, aa1-62, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-583871
• Supplier Catalog Number: 583871
• Alternative Catalog Number: USB-583871-20,USB-583871-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls. For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways. Source: Recombinant protein corresponding to aa1-62 from mouse Calmodulin regulator protein PCP4, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.3kD Amino Acid Sequence: MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14.3
• UniProt: P63054
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.