Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-110, His-KSI-Tag

Catalog Number: USB-583891
Article Name: Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-110, His-KSI-Tag
Biozol Catalog Number: USB-583891
Supplier Catalog Number: 583891
Alternative Catalog Number: USB-583891-20,USB-583891-100
Manufacturer: US Biological
Category: Molekularbiologie
Stabilizes the expansion of the capsid head shell after genome packaging. The packaging of viral genome in the procapsid triggers a dramatic reconfiguration of the capsid shell, expanding from roughly 50nm to 60nm while the capsid thickness decreases. 415 capsid decoration protein molecules cooperatively bind the expanded capsid, thereby stabilizing the mature capsid shell. Source: Recombinant protein corresponding to aa1-110 from Escherichia phage lambda Capsid decoration protein, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.9kD Amino Acid Sequence: MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: P03712
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.