Capsid Protein VP1, Recombinant, Porcine parvovirus, aa1-207, His-Tag, Myc-Tag

Catalog Number: USB-583896
Article Name: Capsid Protein VP1, Recombinant, Porcine parvovirus, aa1-207, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583896
Supplier Catalog Number: 583896
Alternative Catalog Number: USB-583896-20,USB-583896-100
Manufacturer: US Biological
Category: Molekularbiologie
Capsid protein self-assembles to form an icosahedral capsid with a T=1 symmetry, about 22nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangements leading to surface exposure of VP1 N-terminal, specifically its phospholipase A2-like region and putative nuclear localization signal(s). VP1 N-terminal might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell and might contribute to virus transport to the nucleus. Source: Recombinant protein corresponding to aa1-207 from Porcine parvovirus Capsid protein VP1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~26.4kD Amino Acid Sequence: MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKETEHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKAKGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.4
UniProt: P18546
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.