Carbamoyl-phosphate Synthase [ammonia], Mitochondrial, Recombinant, Human, aa1354-1500, His-Tag

Catalog Number: USB-583903
Article Name: Carbamoyl-phosphate Synthase [ammonia], Mitochondrial, Recombinant, Human, aa1354-1500, His-Tag
Biozol Catalog Number: USB-583903
Supplier Catalog Number: 583903
Alternative Catalog Number: USB-583903-20,USB-583903-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the urea cycle of ureotelic animals where the enzyme plays an important role in removing excess ammonia from the cell. Source: Recombinant protein corresponding to aa1354-1500 from human Carbamoyl-phosphate synthase [ammonia], mitochondrial, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.5kD Amino Acid Sequence: GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.5
UniProt: P31327
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.