Carboxypeptidase D, Recombinant, Human, aa383-461, His-Tag, Myc-Tag

Catalog Number: USB-583917
Article Name: Carboxypeptidase D, Recombinant, Human, aa383-461, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583917
Supplier Catalog Number: 583917
Alternative Catalog Number: USB-583917-20
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa383-461 from human Carboxypeptidase D, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~12.3kD Amino Acid Sequence: GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.3
UniProt: O75976
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.