Caspase-12, Recombinant, Mouse, aa1-92, His-B2M-Tag

Catalog Number: USB-583925
Article Name: Caspase-12, Recombinant, Mouse, aa1-92, His-B2M-Tag
Biozol Catalog Number: USB-583925
Supplier Catalog Number: 583925
Alternative Catalog Number: USB-583925-20,USB-583925-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the activation cascade of caspases responsible for apoptosis execution. Source: Recombinant protein corresponding to aa1-92 from mouse Caspase-12, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.3kD Amino Acid Sequence: MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.3
UniProt: O08736
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.