Cathepsin O, Recombinant, Human, aa108-321, His-Tag, Myc-Tag

Catalog Number: USB-583937
Article Name: Cathepsin O, Recombinant, Human, aa108-321, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583937
Supplier Catalog Number: 583937
Alternative Catalog Number: USB-583937-20
Manufacturer: US Biological
Category: Molekularbiologie
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Source: Recombinant protein corresponding to aa108-321 from human Cathepsin O, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~28.5kD Amino Acid Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.5
UniProt: P43234
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.