Cathepsin W, Recombinant, Mouse, aa126-371, His-Tag, Myc-Tag

Catalog Number: USB-583938
Article Name: Cathepsin W, Recombinant, Mouse, aa126-371, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583938
Supplier Catalog Number: 583938
Alternative Catalog Number: USB-583938-20,USB-583938-100
Manufacturer: US Biological
Category: Molekularbiologie
May have a specific function in the mechanism or regulation of T-cell cytolytic activity. Source: Recombinant protein corresponding to aa126-371 from mouse Cathepsin W, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~35.2kD Amino Acid Sequence: VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.2
UniProt: P56203
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.