Cationic Trypsin, Recombinant, Canine, aa24-246, His-SUMO-Tag

Catalog Number: USB-583939
Article Name: Cationic Trypsin, Recombinant, Canine, aa24-246, His-SUMO-Tag
Biozol Catalog Number: USB-583939
Supplier Catalog Number: 583939
Alternative Catalog Number: USB-583939-20,USB-583939-100
Manufacturer: US Biological
Category: Molekularbiologie
Recombinant protein corresponding to aa24-246 from canine Cationic trypsin, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~39.6kD Amino Acid Sequence: IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.6
UniProt: P06871
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.