Cell Surface Hyaluronidase, Recombinant, Human, aa104-250, His-Tag

Catalog Number: USB-583958
Article Name: Cell Surface Hyaluronidase, Recombinant, Human, aa104-250, His-Tag
Biozol Catalog Number: USB-583958
Supplier Catalog Number: 583958
Alternative Catalog Number: USB-583958-20,USB-583958-100,USB-583958-1
Manufacturer: US Biological
Category: Molekularbiologie
Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5kD fragments. Source: Recombinant protein corresponding to aa104-250 from human Cell surface hyaluronidase, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.5kD Amino Acid Sequence: SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.5
UniProt: Q9UHN6
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.