Chemokine CCL20/MIP-3 ALPHA, Recombinant, Macaca mulatta, aa27-96, GST-Tag

Catalog Number: USB-583976
Article Name: Chemokine CCL20/MIP-3 ALPHA, Recombinant, Macaca mulatta, aa27-96, GST-Tag
Biozol Catalog Number: USB-583976
Supplier Catalog Number: 583976
Alternative Catalog Number: USB-583976-20,USB-583976-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa27-96 from Macaca mulatta Chemokine CCL20/MIP-3ALPHA, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.1kD Amino Acid Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.1
UniProt: Q8HYP6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.