Chemokine-like Protein TAFA-1, Recombinant, Mouse, aa20-133, His-Tag, Myc-Tag

Product Overview

• Article Name: Chemokine-like Protein TAFA-1, Recombinant, Mouse, aa20-133, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-583978
• Supplier Catalog Number: 583978
• Alternative Catalog Number: USB-583978-20,USB-583978-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Regulatory factor which is ligand for CMKLR2 and is involved in the modulation of neural stem-cell proliferation and differentiation. Source: Recombinant protein corresponding to aa20-133 from mouse Chemokine-like protein TAFA-1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.2kD Amino Acid Sequence: MLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.2
• UniProt: Q7TPG8
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.