Chitinase Domain-containing Protein 1, Recombinant, Mouse, aa20-393, His-Tag

Product Overview

• Article Name: Chitinase Domain-containing Protein 1, Recombinant, Mouse, aa20-393, His-Tag
• Biozol Catalog Number: USB-583987
• Supplier Catalog Number: 583987
• Alternative Catalog Number: USB-583987-20,USB-583987-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro) (By similarity). Recombinant protein corresponding to mouse Protein DEK, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~44.7kD Amino Acid Sequence: TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 44.7
• UniProt: Q922Q9
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.