Chorismate Pyruvate-lyase, Recombinant, E. coli, aa2-165, His-Tag

Product Overview

• Article Name: Chorismate Pyruvate-lyase, Recombinant, E. coli, aa2-165, His-Tag
• Biozol Catalog Number: USB-583999
• Supplier Catalog Number: 583999
• Alternative Catalog Number: USB-583999-20,USB-583999-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate (4HB) for the ubiquinone pathway. Source: Recombinant protein corresponding to aa2-165 from Escherichia coli Chorismate pyruvate-lyase, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~19.5kD Amino Acid Sequence: SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19.5
• UniProt: P26602
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.