Chromogranin-A, Recombinant, Human, aa224-457, GST-Tag

Catalog Number: USB-584003
Article Name: Chromogranin-A, Recombinant, Human, aa224-457, GST-Tag
Biozol Catalog Number: USB-584003
Supplier Catalog Number: 584003
Alternative Catalog Number: USB-584003-20,USB-584003-100
Manufacturer: US Biological
Category: Molekularbiologie
Pancreastatin. Source: Recombinant protein corresponding to aa224-457 from human Chromogranin-A, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~53.4kD Amino Acid Sequence: QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.4
UniProt: P10645
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.