Chymotrypsin-like Elastase Family Member 3B, Recombinant, Human, aa29-270, His-Tag
Biozol Catalog Number:
USB-584005
Supplier Catalog Number:
584005
Alternative Catalog Number:
USB-584005-20
Manufacturer:
US Biological
Category:
Molekularbiologie
Efficient protease with alanine specificity but only little elastolytic activity. Recombinant protein corresponding to aa29-270 from human Chymotrypsin-like elastase family member 3B, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~28.8kD Amino Acid Sequence: VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted