Chymotrypsin-like Elastase Family Member 3B, Recombinant, Human, aa29-270, His-Tag

Product Overview

• Article Name: Chymotrypsin-like Elastase Family Member 3B, Recombinant, Human, aa29-270, His-Tag
• Biozol Catalog Number: USB-584006
• Supplier Catalog Number: 584006
• Alternative Catalog Number: USB-584006-20,USB-584006-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Efficient protease with alanine specificity but only little elastolytic activity. Recombinant protein corresponding to aa29-270 from human Chymotrypsin-like elastase family member 3B, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.3kD Amino Acid Sequence: VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 32.3
• UniProt: P08861
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.