CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. Source: Recombinant protein corresponding to aa4-196 from human Ciliary neurotrophic factor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.1kD Amino Acid Sequence: TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
