Cobalamin import ATP-binding Protein BtuD, Recombinant, Halobacterium salinarum, aa1-398, His-Tag

Catalog Number: USB-584026
Article Name: Cobalamin import ATP-binding Protein BtuD, Recombinant, Halobacterium salinarum, aa1-398, His-Tag
Biozol Catalog Number: USB-584026
Supplier Catalog Number: 584026
Alternative Catalog Number: USB-584026-20,USB-584026-100
Manufacturer: US Biological
Category: Molekularbiologie
Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system. Source: Recombinant protein corresponding to aa1-398 from Halobacterium salinarum Cobalamin import ATP-binding protein BtuD, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~44.9kD Amino Acid Sequence: MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.9
UniProt: B0R5G4
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.