Complement C1q Tumor Necrosis Factor-related Protein 3, Recombinant, Mouse, aa23-246, His-Tag

Catalog Number: USB-584063
Article Name: Complement C1q Tumor Necrosis Factor-related Protein 3, Recombinant, Mouse, aa23-246, His-Tag
Biozol Catalog Number: USB-584063
Supplier Catalog Number: 584063
Alternative Catalog Number: USB-584063-20
Manufacturer: US Biological
Category: Molekularbiologie
Recombinant protein corresponding to aa23-246 from mouse Complement C1q tumor necrosis factor-related protein 3, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~26.6kD Amino Acid Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.6
UniProt: Q9ES30
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.