Complement Receptor Type 2, Recombinant, Mouse, aa12-140, His-Tag
Biozol Catalog Number:
USB-584082
Supplier Catalog Number:
584082
Alternative Catalog Number:
USB-584082-20,USB-584082-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. Source: Recombinant protein corresponding to aa12-140 from mouse Complement receptor type 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.1kD Amino Acid Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted