Complement Receptor Type 2, Recombinant, Mouse, aa12-145, His-Tag

Catalog Number: USB-584084
Article Name: Complement Receptor Type 2, Recombinant, Mouse, aa12-145, His-Tag
Biozol Catalog Number: USB-584084
Supplier Catalog Number: 584084
Alternative Catalog Number: USB-584084-20,USB-584084-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. Source: Recombinant protein corresponding to aa12-145 from mouse Complement receptor type 2, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~18.7kD Amino Acid Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.7
UniProt: P19070
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.