Cornifin-A, Recombinant, Human, aa1-89, His-Tag, Myc-Tag

Catalog Number: USB-584097
Article Name: Cornifin-A, Recombinant, Human, aa1-89, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584097
Supplier Catalog Number: 584097
Alternative Catalog Number: USB-584097-20,USB-584097-100
Manufacturer: US Biological
Category: Molekularbiologie
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Source: Recombinant protein corresponding to aa1-89 from human Cornifin-A, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.3kD Amino Acid Sequence: MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.3
UniProt: P35321
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.