Crossover Junction Endodeoxyribonuclease RuvC, Recombinant, E. coli, aa2-173, His-SUMO-Tag
Biozol Catalog Number:
USB-584101
Supplier Catalog Number:
584101
Alternative Catalog Number:
USB-584101-20,USB-584101-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5-terminal phosphate and a 3-terminal hydroxyl group. Source: Recombinant protein corresponding to aa2-173 from Escherichia coli Crossover junction endodeoxyribonuclease RuvC, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.6kD Amino Acid Sequence: AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted