Cytochrome b-245 Heavy Chain, Recombinant, Human, aa283-570, His-SUMO-Tag

Catalog Number: USB-584143
Article Name: Cytochrome b-245 Heavy Chain, Recombinant, Human, aa283-570, His-SUMO-Tag
Biozol Catalog Number: USB-584143
Supplier Catalog Number: 584143
Alternative Catalog Number: USB-584143-20,USB-584143-100
Manufacturer: US Biological
Category: Molekularbiologie
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. Source: Recombinant protein corresponding to aa283-570 from human Cytochrome b-245 heavy chain, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~49.2kD Amino Acid Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.2
UniProt: P04839
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.